SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015086 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015086
Domain Number 1 Region: 223-382
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-31
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 358-472
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.32e-18
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015086   Gene: ENSBTAG00000011352   Transcript: ENSBTAT00000015086
Sequence length 901
Comment pep:known chromosome:UMD3.1:5:49181675:49265076:-1 gene:ENSBTAG00000011352 transcript:ENSBTAT00000015086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLPAGGGRTGRPQPEARPEDSGRGVPPAERARGSRDSWEGEEDPEPGEPRGSRTASLV
SGLLTELYSCTEEEEAVGGGRGPRGRQRRRDSLDSSTEASGSDVFLGGRGGAGDSRVLQE
LQERPSPRHQMQYLRQKDMNELETILRELKYRIGIQSAKLLRQLKQKDRLVHKVQRNCDI
VTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTL
ADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLK
RVLLAYARWNKNVGYCQGFNILAALILEVVEGNEGDALKIMIYLIDKVLPESYFVNNLRA
LSVDMAVFRDLLRLNLPELSQHLDTLQKTANKESGGGYEPPLTNVFTMQWFLTLFATCLP
NHTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMGRLTQEMLENDLL
ESHELMQTVYSMAPFPFPQLAELREKYTYNITPFPATVKPTSISGRHGKVRDSDEENDPD
DEDVIANAVGCLGPFSGLLAPELQKYQKQVKESNGDQSLRSNNIAELSPGAINSCRSEYH
AASNSMMMERMTTDINALKRQYSRIKKKQQQQVHQVYIRADKGPVTSILPSQVNSSPVIN
HLLLGKKMKMSNRAAKNAVIHIPGHTGGKISPVPYEDLRTKLNSPWRTHIRVHKKNMART
KSQLGCGDMVGLIEEQSEGSKTHTLGAAKASPSDCVGTAQGGCSDGSTGRTIEGRSPEPV
FGDGDADVSEVQVKIEALELTPRDAAAEPEPRVPPPSQRHFPEPPNAPGGNRVPGKAPQG
GSHPKTPIFSPFPSVKPLRKSTAARNLGLYGPTERTPTVHFPHMSRSFSKSGSGNSSTKK
R
Download sequence
Identical sequences F1MQA4
ENSBTAP00000015086 XP_010803529.1.76553 XP_010826034.1.59421 ENSBTAP00000015086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]