SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015213 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000015213
Domain Number - Region: 662-726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0197
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015213   Gene: ENSBTAG00000011448   Transcript: ENSBTAT00000015213
Sequence length 730
Comment pep:known chromosome:UMD3.1:10:72027465:72101711:-1 gene:ENSBTAG00000011448 transcript:ENSBTAT00000015213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSSKMALSSWSPELGLGSEKALPVAAVSTGPSLELCTFPSTLGSSVATDALEQLLVVE
QSLQSDYFKCNEEAKNFLKDVAIAVKKLEEMRKSTIDLLEIESMELSRLYFVLETLPTSV
SRELEECVRDARRVNLVEMSELHTKITRINDEIEFLKKKILHLQTDNTALGERQEELAKH
YGKIVLSVNHAMKEKATTTIYINETYTKINLEKKELELQKTYIQEIEEQIERERAEYLKK
KEKLNQEIEEYKKLCELKRKETYAKKKELDKLRLTMTKMRETVTTSTVVLSDHNLELARL
QESIREWEHKIEDMKKSCKILEDKMLFFKNNREKLDDSSNFEKSELLLKIKQMTEKLHNC
RLENKALREKLHTVSRQYKIVLNEEDKVFMQKRKIYSENQKQLAFIAQKENFLSKRKVDI
KNMEEGLITLGELHRATKEVYRKQIKILNENMERETQRCIITQWKIACLRKKHARWVKKI
KDEIKELIDKIQEAENRRSELIEETSIREHDINEFLAKIEQLTLELKQEEDAFVIKERKL
IQELSKFEQRFAEEAQISKEKEVELDKCLPQLQVAEEEFTDKNRKFQNLIETVTAQKNEQ
NLLNNNISQFTRDFIRYINNTKKVKQELKQLREHESYKTKAHFEILKSLENEIYLHDLKT
DALILENKRLKEYIAYLKDNIEQYERGGEDLVRSSSDLSCQLTDLQTQYSDLWAEFWTTL
KKRRKRVLLK
Download sequence
Identical sequences A0A140T884
NP_001033310.1.59421 NP_001033310.1.76553 ENSBTAP00000015213 ENSBTAP00000015213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]