SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015397 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015397
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.67e-53
Family Dual specificity phosphatase-like 0.000000077
Further Details:      
 
Domain Number 2 Region: 200-376
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-46
Family Dual specificity phosphatase-like 0.0000000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015397   Gene: ENSBTAG00000011589   Transcript: ENSBTAT00000015397
Sequence length 498
Comment pep:known chromosome:UMD3.1:8:84629264:84748968:-1 gene:ENSBTAG00000011589 transcript:ENSBTAT00000015397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKSERRPNWAAAPPCSRRCSLSSPGVKKSRSSTSQELHHLDQQDDLYLDITHRLCFAI
LFSRPKSSSNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMMRKKIIH
FTGPDQRKQANAAFLVGCYMVIYLGKTPEDAYRILMFGDATYIPFRDAAYGSCNFFITLL
DCFYAVKKAMQYGFFNFNSFNLDEYEYYEKAENGDLNWIIPDRFLAFCGPHSRTRLESGY
HQHSPEAYIPYFKNHNVTTVIRLNKRMYDAKRFTNAGFDHYDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTATETIAWVRICRPGSVIGPQQQFL
MMKQASLWIEGDYFRQKLRGQENGKHRAAVSKLLLAVDDISINGVENQDKQEPELYSDDD
EISGVTQGDRLRALKSRRQSKTNALPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSFKSPSISRTKTVLR
Download sequence
Identical sequences E1BMN3
ENSBTAP00000015397 ENSBTAP00000015397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]