SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015461 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015461
Domain Number 1 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-17
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000318
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 1-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000142
Family SCAN domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015461   Gene: ENSBTAG00000047236   Transcript: ENSBTAT00000015461
Sequence length 381
Comment pep:known chromosome:UMD3.1:18:63789245:63795222:1 gene:ENSBTAG00000047236 transcript:ENSBTAT00000015461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLVLEQFVMCMPQDIQVLVKSSGAETCKDLEEVLRKKQKLKKWAVVRVQGEDFLMPV
SGVEILGSEVSERHGEEDQAREPQSTVSVIPPDEGQQESGDGQHLPGAKDLLRGQHQKAL
LPETIPETGQLEGQTPSKEYLVKDVLEDTGVTRTLSSQEPELLQDREGDVSTPSGSRGGP
LKNRRRVKRKRDSSPTCQDVCQEAATCLDQEEFSGQLGSRSVGASGTVGPTSLPERAETL
GRAPSECKVCKKSFPYQSQLTVHQRTHTGERPFQCDICAKGFIQLSDLRVHEQIHTGVKP
YSCDLCLKKFTHDSTLHTHKRTHTQEKPFRCEHCDRAFSHRGNLNVHRRTHSGLKPYVCP
ECHSAFRQLGTFTHHQKIHSR
Download sequence
Identical sequences G3X6X7
ENSBTAP00000015461 ENSBTAP00000015461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]