SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015484 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015484
Domain Number 1 Region: 12-289
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015484   Gene: ENSBTAG00000011658   Transcript: ENSBTAT00000015484
Sequence length 454
Comment pep:known chromosome:UMD3.1:2:1263538:1282763:1 gene:ENSBTAG00000011658 transcript:ENSBTAT00000015484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLDAARSFLEQLEALGGRHGVVFAGEFSDIRARSAAWKTESVRSTEAGSRPENVRKN
RYKDVLPYDQTRVILSLLQEEGHGDYINGNFIRGTDGSQAYIATQGPLPHTLLDFWRLIW
EFGVKVILMACQEMENGRKKCERYWALQQEPLQIGPFCITLTRDMWLNPDIKLRILQVTF
QKESRSVFQLQYMSWPDRGVPSNPDNVLAMVEKARHLQGSGPNPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPNFSLFSVVLEIRKQRPLAIQTEEQYRFLYHTVSQMFLSAIQNAS
PHYQNLKENCVPLYDDALSLWTSQNLNAIARPSSGVLRSISVLGPPALSMADTYAVVQKR
AAPAGTGAGAGARARGTEDTPLYSQVKPRAWRHQALSEDARGAQQGRVPVDESLAGPGAY
EDVADRAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Download sequence
Identical sequences F1MDF1
XP_005202238.1.76553 ENSBTAP00000015484 ENSBTAP00000015484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]