SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015510 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015510
Domain Number 1 Region: 459-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-18
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 504-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000212
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 3 Region: 412-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000626
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015510   Gene: ENSBTAG00000011682   Transcript: ENSBTAT00000015510
Sequence length 1548
Comment pep:known chromosome:UMD3.1:2:72977209:73168370:1 gene:ENSBTAG00000011682 transcript:ENSBTAT00000015510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPHLLPPFHAPFPIDMRHQEGRYHYEPHSVPGVHGPPALSGSPVISDISLIRLSPHPAGP
GESPFNAPHPYVSPHMDHYLRAVHGSPTHPAISAARGLSPADVAHEHLKERGLFGLPAAG
TNASDYYHQMTLMAGHPAPYGDLLMQTGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRK
RALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHP
INPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPVAFTSINATPTQLSSSSNCLSD
ANQNKQSSESAVSSTVNPIIIHKRSKVKTEADGLRPASPLTLTQVCLHLDQPMGPWHSLH
GADSDLSPGPGGRTRLTWVCSAPLPQEQLADLKEDLERDDCKQEAEVVIYETNCHWEDCT
KEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKC
TFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYI
CKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRAPLLRENGDSEAGAEPGRG
SEDNAEASSTSQAVEDGLHVKAIKTERSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEM
PGTGPGSLADLTALEDPPPGADTSALAAPSAGGLQLRKHMTAMHRFEQLKKEKLKSLKDS
CSWAGPAPHTRTSKLPPLPGSGSVLENFSGGGGGGPAGLLPNPRLSELFPGEVTVLSHLQ
ERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASPLGAGRAHPASSADSYDPISTDAS
RRSSEASQCGGGPGLLQLTPAQQYSLRAKYAAATGGPPPTPLPGLERTSLRTRLALLDAP
ERALPAACLRPIGPRRGSDGPHYGPSGPLPAFPHEAPGGGARRASDPGRRPDALAAPRVQ
RFHSALDVTPGTLPPPCGQGRGLRLQSHTSADGSLARSGYSPRPPSISENVVMEALAAGA
DGTGPEVSLGLPEDDLVLPDDVVQYIKARTSGTLEESTPPVYPPESTCFSENPKLPSPGL
HGQRTIAAADSNVGPSAPVLGGCPLGYGAPSSLNKNSMPVQWNEVSSGTVDALASQVKPL
PFPQGNLAVVPQKPAFAQYPGYNPQGLQPSPGGLDNSQPHLQPYSGAPSAPRGNYTQQLR
QPGAGSQCPNMTAAVNPHPGYGQAHPQLSTMGGTLNQFPSSCSNMATKPGHLGLPQQMEV
APDPTMMGNSHRELGMPNSSLAGMPPPHPAQNYPQQSHHLVTTMSQEGYHQGPNLVPSHQ
PSFMEPQQGTMGAAGSSFGLMQPRPPPEPGPAGRHRGVRAGQQLAYARATGHAMAAMSAN
QEMTESVPKGTMGSMLSLPPQPPPQDTGGTQDHSMLYYYGQIHMYEQNGGPENQAGCQAL
RPQPTQPQALPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDSDHSSLLSGALSPSLLHGLS
QSSSRLTTPRSSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
Download sequence
Identical sequences F1MCY1
ENSBTAP00000015510 ENSBTAP00000015510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]