SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015809 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015809
Domain Number 1 Region: 740-1073
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-112
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000358
Further Details:      
 
Domain Number 2 Region: 7-139
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 1.83e-47
Family USP8 N-terminal domain-like 0.00000042
Further Details:      
 
Domain Number 3 Region: 178-322
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 9.79e-33
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.000000397
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015809
Domain Number - Region: 615-650
Classification Level Classification E-value
Superfamily WW domain 0.0119
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015809   Gene: ENSBTAG00000011916   Transcript: ENSBTAT00000015809
Sequence length 1085
Comment pep:known chromosome:UMD3.1:10:59984279:60037841:-1 gene:ENSBTAG00000011916 transcript:ENSBTAT00000015809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFMQQQDHFHSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEKEQLQKQKKQEAEREDDSTSDKSSLENVLDAKDKTQKINGEKSEKNETTEK
GAITAKELYTMMMDKNISLIIMDARRMQDYLDSHISDSLSVPEEAISPGVTASWIEANLP
DDSKDTWKKRGSVDYVVLLDWFSSAKDLQLGTTLRSLKDALFKWESKAVLRSEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSVSLDFTYPSLEESVPSKPTAQMIPPIEISEN
TELINSQDERMGPLNISAPVEPIAASKYDVSPIIQPVPILKNIPQIDRSKKPAIKLPEDH
RIKYESTDHEEQSPQSEKVVPDRSTKPVFPPPTAMLTDEEKARIHAETVLLMEKNKQEKE
LRERQQEEQKERLRREEQEQKDRKEQEAEENEITEKQQKAEQMEKKESEQARKEDKETSA
KRGREITGVKRQSKSEHETTDAKKSVEDRGKRCPTPEVQKRSADVPHASVAGDSSSGKSR
EPLTRARSEEMGRVVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTP
PTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRRPTVTPAVNRENKPTSYPKAE
ITRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNTPHLADYFNRNCYQDD
INRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELL
LFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKST
VQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRD
SLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNL
FSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISISSVKSSAAYILFYTSLGPRI
TDVAT
Download sequence
Identical sequences Q0IIM6
ENSBTAP00000015809 NP_001069594.1.59421 NP_001069594.1.76553 XP_010807664.1.76553 XP_019824405.1.53367 ENSBTAP00000033723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]