SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015943 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015943
Domain Number 1 Region: 517-697
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0026
Further Details:      
 
Domain Number 2 Region: 675-788
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015943
Domain Number - Region: 372-431
Classification Level Classification E-value
Superfamily Tropomyosin 0.0412
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 126-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0523
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015943   Gene: ENSBTAG00000012022   Transcript: ENSBTAT00000015943
Sequence length 844
Comment pep:known chromosome:UMD3.1:21:30902155:30968114:-1 gene:ENSBTAG00000012022 transcript:ENSBTAT00000015943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APNRQLMTYWLQELQQKRWEYCNSLDVVKWDSRTSPTPGDFSQGLVARDNTDLINLHSNA
SAEKARNVLAVEAAPGELVGEQAANQPAPGPPNSINFSFKQWGTELRNSMSSFRPGKGHN
DSRRSVFYTNEEWELLEPSPKELEESMVQEERKKQAPEGNKGITGSGFPFDFGRIPYKGK
RPLKEMIGSYKNRHSIGDPSPEVPSGSGSASKPASEMQLLVQNQQEELERLRKDLASQKE
LVRLLQQTVRSSQYDKYFTSSRLCDGVPQDTLGLLHQKDEQILGLTNQLERFNQEKDSLQ
QEVRMLKSKVGELSERLGMLMETIQAKDEVIMKLSRQLSECEGSASSPTCIPGSPVAAPA
GRDQLELDWLKDNLQGYKTQNKFLNKEILELAALRRNAERRERDLMAKYSSLEAKLCQIE
SKYLILLQEMKTPVCSEEQGPARDVIAQLLEDALQVESPEHPEQAFIKPHLVSEYDIYGF
KTVPEDDEEEKLVARVRALDLKTLHLTENQEVSTGVKWENHFASTVNREMACSPELKNLV
RAGIPHEHRSKVWKWCVDRHIKKFKDSTQPGYFQTLLQKALEKQNPASKQIELDLLRTLP
NNKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIV
EVFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHAHFEQYKVDYTLITFNWFLVVFVDS
VVSDVLFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDAR
KLIGISFGDLNPFPLRQIRNRRAYHLEKVRLELTELEAIREDFLRERDTSPDKGELVSDE
EEDT
Download sequence
Identical sequences F1MC26
ENSBTAP00000015943 9913.ENSBTAP00000015943 ENSBTAP00000015943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]