SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016000 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016000
Domain Number 1 Region: 745-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 388-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 800-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 691-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 428-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 567-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000408
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000105
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 9 Region: 470-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000114
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 200-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000908
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 321-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000102
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 251-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000016000
Domain Number - Region: 518-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00153
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016000   Gene: ENSBTAG00000012064   Transcript: ENSBTAT00000016000
Sequence length 877
Comment pep:known chromosome:UMD3.1:18:56790637:56796623:1 gene:ENSBTAG00000012064 transcript:ENSBTAT00000016000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFQEIATLKDIAMDFTSENWEQLGQGQGDLFWDMALDNYWNLFLLNPPGPNLTFHPDGGE
KLEALVKESPESTDTGIAETSPLPQDFLEAGLFQEITETFSKDDLWNSHLGEASIGQTWL
DSLLGDSESLLRSDIISLESPTECKSHKFKSHELKIDLSPESHLSPGAGSMTLDLPEKSL
APAKSQECGNDFGCYSDHSQHDTIQGGEKPYECSECGKSFSQSYHMIQHWILHNREQHPT
VLQEYEKDVNQRSCLSMQPVTHTGYKSYVYNKFGETFSENTHLLCHQKVHTEEEPWESQD
GDCPADHNSQPFECHKPPPGKTYNCKECGQSFSQTFHLSVHQKTHTQKCYECAKCKATFN
SNRYLLQHQKIHAAKMIPEDQECGKACKQSSFLVQQQSVHTAEKPYKCDECEKTFSHSLA
LKIHQRVHSGEKNYKCNECGKAFYRNSHLSEHQRVHTGYRPHKCHKCVKSFSRPSHLIRH
LSMHATEKLYSCAKCKKTFSHNEHLVQHQKIHAVETPECQECGEQLVCRSTLICHQSIHN
REKGLSESQEILYEKPEHREHPRICGKRFKCNKCEKTFHCRKYLTQHKLIHARVKPFECN
HCGKAFGQSSHLIWHQKIHSRLRSYRCGDCGKAFIYRTSLIKHQSLHVIEHPFKCNECGR
IFSQSACLLEHQLIHTTKKPLIPNKCDVLAHSNHLIQHQRVHTGEKPYICQECGKTFSQS
SCFSKHQRIHKGEKSYKCDSGGKAFIRGTPLIQHQRIHTGEKPYVCQECGEAFQQGSCLS
KHQRVHTREKLYVCAKCGKAFAQKTNLMQHETTHTGEKPYACGVCGRAFRLRAHLSQHQR
IHTQEKSYQCQHCQKALCCCSGLSRQQRIRYNKYTLL
Download sequence
Identical sequences F1N038
ENSBTAP00000016000 9913.ENSBTAP00000016000 ENSBTAP00000016000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]