SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016314 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016314
Domain Number 1 Region: 205-404
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.2e-47
Family Ypt/Rab-GAP domain of gyp1p 0.00000644
Further Details:      
 
Domain Number 2 Region: 380-504
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016314   Gene: ENSBTAG00000012291   Transcript: ENSBTAT00000016314
Sequence length 515
Comment pep:known chromosome:UMD3.1:5:118086468:118343833:1 gene:ENSBTAG00000012291 transcript:ENSBTAT00000016314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDGARKQFWKRGSSKVPGSIQHVYGAQHPPFDPLVHGTLLTATPKVPTTPVKATRAST
FQEFESSTSDAWDAGEDDDELLAMAAESLNTAVVMETAHRVLRNHSQRQGRPRPPGAPEP
SAEPSVDPSAAPGGDLRLVKSISESHASCPEGSASDAAPLQRSQSLPHAATVALGGAPEP
SALSTSALSEREASRLDKFKHLLAGPNTDLEELRKLSWSGIPKPVRAITWKLLSGYLPAN
VDRRPATLQRKQKEYFAFIDHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIF
ERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIDDEDADSADISRVPEDVLRNVEAD
TYWCMSRLLDGIQDNYTFAQPGIQMKVKLLEELVSRIDEQVHRHLGQHEVRYLQFTFRWM
NNLLTRELPLRCTVRLWDTYQSEPEGFANFHLYVCAAFLVRWRKEILEERDFQELLLFLQ
NLPTAHWGDEDVSLLLAEAYRLKFAFADAPNHYKK
Download sequence
Identical sequences F1MZ74
ENSBTAP00000016314 ENSBTAP00000016314 9913.ENSBTAP00000016314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]