SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016535 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016535
Domain Number 1 Region: 55-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000595
Family HkH motif-containing C2H2 finger 0.021
Further Details:      
 
Domain Number 2 Region: 125-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000563
Family HkH motif-containing C2H2 finger 0.012
Further Details:      
 
Domain Number 3 Region: 233-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000022
Family HkH motif-containing C2H2 finger 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016535   Gene: ENSBTAG00000012463   Transcript: ENSBTAT00000016535
Sequence length 289
Comment pep:known chromosome:UMD3.1:1:88632287:88663997:1 gene:ENSBTAG00000012463 transcript:ENSBTAT00000016535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLQHAGLPPPKRPSSSPPMSVAARSTGALQLPPQKPFGQEASLPLAGEEEPPKGGEQD
TALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNAVEAV
AAPAVSVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSDSSEVGQRRTRKEGNEYKMMPNRRNMYAVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEVEFRQHLESKQHKSKVSEQRYRNEMENLGYV
Download sequence
Identical sequences L8IT64 Q0IIC4
ENSBTAP00000016535 ENSBTAP00000016535 9913.ENSBTAP00000016535 NP_001069576.1.59421 NP_001069576.1.76553 XP_005201717.1.76553 XP_005892556.1.15283 XP_010853910.1.44457 XP_019814998.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]