SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016559 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016559
Domain Number 1 Region: 11-74,106-140,205-302
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.33e-45
Family Ypt/Rab-GAP domain of gyp1p 0.00056
Further Details:      
 
Domain Number 2 Region: 280-397
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-34
Family Ypt/Rab-GAP domain of gyp1p 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016559   Gene: ENSBTAG00000012480   Transcript: ENSBTAT00000016559
Sequence length 399
Comment pep:known chromosome:UMD3.1:11:99298021:99311444:1 gene:ENSBTAG00000012480 transcript:ENSBTAT00000016559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLHKSRIADFQDVLKEPTIALEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWT
SILAKQRELYSQFLREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFRDNEVL
LQIDKDVRRLCPDISFFQRATEYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVT
NMSSPQKNSAPSMNEYVVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPLYYT
FATDPNSEWREHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYKMEKVYSTLKDKDME
LYLKLQEQNIKPQFFAFRWLTLLLSQEFVLPDVIRIWDSLFADSNRFDFLLLVCCAMLIL
IREQLLEGDFTVNMRLLQDYPITDVCQVLQKAKELQDSQ
Download sequence
Identical sequences F1MXD4
ENSBTAP00000016559 NP_001193644.1.59421 NP_001193644.1.76553 XP_005908551.1.15283 XP_010855126.1.44457 ENSBTAP00000016559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]