SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016579 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016579
Domain Number 1 Region: 170-509,590-611
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.71e-78
Family Myotubularin-like phosphatases 0.0000152
Further Details:      
 
Domain Number 2 Region: 16-146
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000123
Family GRAM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016579   Gene: ENSBTAG00000012496   Transcript: ENSBTAT00000016579
Sequence length 665
Comment pep:known chromosome:UMD3.1:3:20718768:20726741:1 gene:ENSBTAG00000012496 transcript:ENSBTAT00000016579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPRSRQLGSCLASGGLPGEQILAWAPGVRKGLEPEMPGTLICSNLRVTFQPHGWQRSQ
ETPLSSEYDFSLANIGRLEAVHGPSRVQLLRPGSLLKFIPEEILIHGQDFRLLRVGFEAG
GLEPQAFQVTMAIVQARAQNSPAQQYAGITLSQAGQSSDSRKPPIPLLETIEDWETERKK
QAARGWRVSTVNERFDVATSLPRYFWVPNRTLDSEVRRAFGHFHQGRGPRLSWHHPGGSD
LLRCGGFYTASDPNKEDIRAVESMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLP
DSSVAEDKWFSALEGTRWLDYTRSCLRKASDISVLVTSRVRSVVLQERGDRDFNGLLSSL
VQLLSAPEARTLLGFQSLVQREWVAAGHPFLTRLGGSGASEEAPVFLLFLDCVWQLLQQF
PAEFEFSEFFLLALHDSVRVPDTLTFLRDTPWERGKQSGQFNNYTQVYTPGFPGAGNSIN
PQLSVWDWNLRYSNKQILQFRNPGYDPEHCPDSWLPRQQPSFMVPGPPSSVWLFSRGSLT
PLNQLCPWRDSPSLLAVSSRWLPRPAISSESLADQEWGLPSHWGACPLPPGLLLPGCLGP
QIRLWRRCYLRGRPEVQMGLSAPTISGLQEELSHLQELLRKWTPRISPEDHSKRRNPNTI
LSQSR
Download sequence
Identical sequences F1MWR0
ENSBTAP00000016579 ENSBTAP00000016579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]