SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016732 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016732
Domain Number 1 Region: 49-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 186-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000337
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 146-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000156
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 223-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000186
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 96-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000482
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 272-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000789
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016732   Gene: ENSBTAG00000012600   Transcript: ENSBTAT00000016732
Sequence length 357
Comment pep:known chromosome:UMD3.1:12:32723124:32733098:-1 gene:ENSBTAG00000012600 transcript:ENSBTAT00000016732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPPASVAEAVSSLTIADAFVAAGEGAAPPPQAPPRSFICSFPSCSAAYNKAWKLDAHLC
RHTGERPFVCDHEGCGKAFVRDYHLSRHALIHTGEKPFVCTASGCEQKFNTKSNLKKHFE
RKHENQQKQYTCSFEGCEKTFKKHQQLKTHQCQHTNEPLFKCAHEGCGKHFASPSSLKRH
GKVHEGYICQKQCSFVAKTWTELLKHMRETHKEDIRCGVCQKTFKRKDFLRQHMRMHAPE
RDVCRCPRAGCGRTYTTAFNLQSHILSFHEQQRPFVCEHAGCGKTFAMKQSLSRHAVVHD
PNMKKTKVRPSRGKRSLASRLSGYVPPKRTQGQAVPLPRNGEPLSCMEGHVLSTSPC
Download sequence
Identical sequences F1MUY9 L8I945
ENSBTAP00000016732 ENSBTAP00000016732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]