SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016756 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016756
Domain Number 1 Region: 113-229
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-34
Family Canonical RBD 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016756   Gene: ENSBTAG00000012622   Transcript: ENSBTAT00000016756
Sequence length 281
Comment pep:known chromosome:UMD3.1:4:32250996:32269539:-1 gene:ENSBTAG00000012622 transcript:ENSBTAT00000016756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGRRRDSYYDRG
YDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
Download sequence
Identical sequences A0A288CG19 Q2KJ71
9913.ENSBTAP00000016756 NP_001039845.1.59421 NP_001039845.1.76553 XP_003982899.1.62641 XP_004397391.1.74151 XP_004418977.1.5094 XP_005656747.1.46622 XP_005901321.1.15283 XP_006069685.1.26621 XP_006179252.1.101512 XP_006729457.1.47382 XP_007089116.1.5354 XP_007108639.1.24612 XP_007447518.1.90284 XP_008533993.1.77740 XP_010985489.1.51371 XP_014335436.1.15283 XP_014686039.1.49734 XP_019299148.1.44245 XP_019784305.1.83887 XP_019814104.1.53367 XP_020732151.1.74333 XP_021545274.1.83697 XP_539475.3.84170 ENSBTAP00000016756 ENSBTAP00000016756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]