SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016763 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016763
Domain Number 1 Region: 287-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-18
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 335-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000185
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016763   Gene: ENSBTAG00000012629   Transcript: ENSBTAT00000016763
Sequence length 416
Comment pep:known chromosome:UMD3.1:2:121242594:121268659:-1 gene:ENSBTAG00000012629 transcript:ENSBTAT00000016763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPP
TSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGI
SSRTPAVSTSESSAGTGTSSPSTPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQGHGL
LGPPKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRCKVCPLTFFTKSEMQI
HSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLSHLQQHTRI
HTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHLSAHA
IKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPSIPVRISLI
Download sequence
Identical sequences F1MUJ5
ENSBTAP00000016763 ENSBTAP00000016763 NP_001179097.1.59421 NP_001179097.1.76553 XP_006054734.1.26621 XP_011996611.1.54773 XP_011996612.1.54773 XP_017913588.1.57651 XP_017913590.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]