SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016859 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016859
Domain Number 1 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-24
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 246-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 182-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000164
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016859   Gene: ENSBTAG00000004262   Transcript: ENSBTAT00000016859
Sequence length 554
Comment pep:known chromosome:UMD3.1:7:2347258:2366394:-1 gene:ENSBTAG00000004262 transcript:ENSBTAT00000016859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRCLPAMVRESVTFKDVAVLFTQDEWAQLSPAQRALYRDVMLENYSNLVSLETGLLGP
KPDMFSQLGKGEEWMPEDSLGGFCLASADDPVFPHISSSSVCQNQICVRIDWVITPMNKK
SILKADIPEGELGQWMIKERFTRDSCWKYDDLLEWQHGGQEINLEQVVLAHEKTSSVVGD
QKCDESGKPGTMNSSFVQSQGFQSSKKAFECSECGKVFTKSSTLNKHQKIHSEKLNANQK
IVIKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTG
EKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICDKAFVCRAHLTKHQNIHSGEKPY
KCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNE
CGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKA
FSDHSALTQHKRIHTREKPYKCKICGKAFIRSTHLTQHQRIHTGEKPYKCNKCGKAFNQT
ANLIQHQRHHIGEK
Download sequence
Identical sequences E1BCD8
ENSBTAP00000016859 ENSBTAP00000016859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]