SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016862 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016862
Domain Number 1 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 508-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016862   Gene: ENSBTAG00000002955   Transcript: ENSBTAT00000016862
Sequence length 571
Comment pep:known chromosome:UMD3.1:28:13166933:13179478:-1 gene:ENSBTAG00000002955 transcript:ENSBTAT00000016862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFEDVTVGSTQEEWQKLDPAQRTLYRDVMLENYSHLISVGYCIPKPELIFKLEQGE
HPWVLEAESPSQSYPVRHCSVEKLLETSKLKQKKKKEPILFCYITYNLEKGGEKKDSVVT
ELDVQNILNRKIIRKIPCKCDTSGMSLKYISELIIEKNYLRKKFGELSAYEKLFLHVNHE
KLIKYVSQNEDFFPYEKIKHVEQSFEYKECGEDFCEKTVSSLLMVHKIRESLYEFSEYGK
TFEKSVLNVTQKTCIGDKVYECNECEKAFCEKSKLTKQQRVHTGEKHYECNECGKCFSRN
SYLIIHQRIHTGEKPYECKECGKSFYHKSYLTIHQRIHTGEKPMNVCNQCGKFFRNSYLT
IHQRTHTGEKPYECKECGKTFSRNSGLKVHQRTHTKEKPYECNECGKSFSEKSVLTVHQR
IHTGEKPYKCNECGKTFYNKSDLTKHQRTHTGEKPYECKECRKFFSRNLYLTVHQRTHTG
EKSYVCKKFGKTFYYKSDYTVHKRTHRGEKLYYCDQCGKTFICNSVLRSHQRTHTGEKPY
ECNDCGKSFSEKSVLIVHQRIHTGEKPYKGN
Download sequence
Identical sequences F1MUX8
ENSBTAP00000016862 ENSBTAP00000016862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]