SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016870 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016870
Domain Number 1 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-24
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 544-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 212-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 297-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000325
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 608-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000185
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016870   Gene: ENSBTAG00000033523   Transcript: ENSBTAT00000016870
Sequence length 646
Comment pep:known chromosome:UMD3.1:2:14443706:14445836:-1 gene:ENSBTAG00000033523 transcript:ENSBTAT00000016870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQQQMTVEDVAIKFTPEEWECLSPAQRTLYWDVMLETYRNLLSVDISPIHIIKKLQS
KENTNSTDTLQTVILGRHESHGVQDFYLREIRGNTLEFECQWKDDERNYKGVLVIHNEKL
TDRKDQRGRSNAGNNAIENKLALSFQDELQIFRMERKIFECNQVENVINNSSSISALQRI
PPSVQTNTSNMYGNNFIHSSILTKDHKAHREKPYRCNDCDKTFTHVSHLTKHQVVHTGER
PYKCDTCGKDFSQSSNLATHRRIHTGEKPYKCNECGKDFNRKSNLETHQRIHTGEKPYKC
NVCGKAFRVCSSLRSHQVIHTGEKDYHCSKCNKAFSRNSKLLKHQRIHTRGQPYKCDACD
KAFILRSSLINHQVVHTRGKSYPCNECGKMFIKRSHLRLHERIHTGEKPYKCTECGKGFR
QWSDIRIHLRIHAGEKPFKCSKCGKSFTRSSHLTRHQIIHTGEKPYKCEVCDKFFSRNSH
LAGHWRIHTREKPYKCNECGKAFSDRSSLTYHQVIHTGEKSYKCNECGKAFIKPSYLRHH
ERIHTGERPYKCTECGKAFIKLSHLRYHERIHTGEKPYKCTECGKAFQQWSDITIHQRIH
AGANPLAFEASVNTRIHQRIHSGEKLYQFHECGKTFAQGLHLPNHQ
Download sequence
Identical sequences E1BCC4
ENSBTAP00000016870 ENSBTAP00000016870 9913.ENSBTAP00000016870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]