SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016933 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016933
Domain Number 1 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000121
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 818-869
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000752
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 1017-1067
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000136
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 335-343
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000017
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000016933
Domain Number - Region: 435-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00735
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016933   Gene: ENSBTAG00000012738   Transcript: ENSBTAT00000016933
Sequence length 1083
Comment pep:known chromosome:UMD3.1:17:12587397:12739481:1 gene:ENSBTAG00000012738 transcript:ENSBTAT00000016933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPLRSQGEIVPLRNQEYVSRQDEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLCLED
RIQEQSTSPDTSLGSATPSSHTLELVALDGEVLRDPLQCPDHLSPGVSSLCEEDHPGSTK
PLSSNLRRLLEAGSLKLDAAATANGRVESPVNAGSNLSFSPPSHHAQQLSVLARKLAEKQ
EQNDQYPPSNRFLWNQGKWLPNSTTTCGLSPDSAILKLKAAANAVLQDKSLTRTEETVRF
ESFSSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAAR
AAGTLLAEKSSLVPEDPLPPPPSEKKQEKVTPPPPPPPPPPPPPPPQSLELLLLPVPKGR
VSKPSNSASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNL
KSHMKVHQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEETPDPEAKGP
PHLSDSACLGQQREGGGTELVGTMMKSSTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFP
LNATDRPANHTKLREPSEFAANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKIK
EEPKEEETLSVTLPRSSYVFSPESEVSAASISEDTLKPQEAKGNVLRRDMSVKAASELLM
KLSAESYKDTQMVKIKEEPMEVDIQDSQVSISPSCNVGYSTLIGREKTEPLQKLPEGRVA
PERNLFSQDISVKMASELLFQLSEKVSKEHTQKENTIRTTTSPFFSEDTFRQSPFTSNSK
DLLPSESVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSL
HTEERKYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYS
CHVCGFETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKAHIGTKHTGEDRK
TPSESNSPSSSSLSALSDSANSKDDSDSSQKNKSGSNLLVISVMPGSQPSLNSEEKPEKG
FECVFCNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNS
GQW
Download sequence
Identical sequences F1MWZ3
ENSBTAP00000016933 ENSBTAP00000016933 9913.ENSBTAP00000016933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]