SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016940 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000016940
Domain Number - Region: 61-166
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000155
Family Brix domain 0.024
Further Details:      
 
Domain Number - Region: 292-360
Classification Level Classification E-value
Superfamily FlgN-like 0.0667
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016940   Gene: ENSBTAG00000012745   Transcript: ENSBTAT00000016940
Sequence length 469
Comment pep:known chromosome:UMD3.1:7:15890245:15894250:1 gene:ENSBTAG00000012745 transcript:ENSBTAT00000016940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSGRSRHQKRARAQAHLRNLEAYAAQPHSFVFARGRVGRSVQQLSMDLRRVMEPLTAT
RLQIRKKNSLKDCVAVAGPLGVTHFLIVSKTETNVYFKLMRLPGGPTLTFRINKYTLVRD
VVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRC
LLINYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSES
EAEPDGEHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLELIKIQEGVGEGNVLFHRL
VHKTEEELQAILAAKEEKLRLKAQRQDQQAQNVRRKREQREAHKKKSLAGMKRARAEADG
DSDAEDPGAPPEAERTSQQEEEEDEAEYFRQAVGEEPDEDMFPKAAKRRRPTGPPGKKQR
LKERKPDRGSDRRPQKAKGKGPGAQAKVGPRGAARNRGQGRPRPLKRAA
Download sequence
Identical sequences F1MWS9
ENSBTAP00000016940 9913.ENSBTAP00000016940 ENSBTAP00000016940 NP_001039726.2.59421 NP_001039726.2.76553 XP_005910913.1.15283 XP_010826688.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]