SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016974 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016974
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000276
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016974   Gene: ENSBTAG00000012772   Transcript: ENSBTAT00000016974
Sequence length 331
Comment pep:known chromosome:UMD3.1:11:103039731:103051510:1 gene:ENSBTAG00000012772 transcript:ENSBTAT00000016974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKKAHTYHQPRTREDELLWPLALGPVARDQVPSISPVLSSLFPNQRLDWTDL
KREPQLELEQSSMTRLASGPEGPAVTSRPQDGDSPSSDSPPFYKPSFSWDTLASSYGHSY
RQAPSTMQSAFLERSVSLYGSPLVPSAEPPLDFSLHYSPGMDAYHCIKCSKVFSTPHGLE
VHARRSHSGTRPFACNVCGKTFGHSVSLEQHTHVHSQERSFECRMCGKAFKRSSTLSTHL
LIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHT
GFKPFSCELCAKGFQRKVDLRRHRESQHNLK
Download sequence
Identical sequences F1MWJ8
NP_001179849.1.59421 NP_001179849.1.76553 ENSBTAP00000016974 ENSBTAP00000016974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]