SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017001 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000017001
Domain Number - Region: 164-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000292
Family Classic zinc finger, C2H2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017001   Gene: ENSBTAG00000012796   Transcript: ENSBTAT00000017001
Sequence length 194
Comment pep:known chromosome:UMD3.1:18:52165404:52174453:-1 gene:ENSBTAG00000012796 transcript:ENSBTAT00000017001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEDEEEEEEEETTDDPE
YDPGYKVKQRLGGGRGGPSRRAPRAAQPPGPPAQPCQLCGRSPLGEAPPGTPPCRLCCPA
VAPQEAPAPETRALGEEEGGAPRAGEGRPTGRDEEDEEEEEEEEGTYHCTECEDSFDSLG
ELHGHFMLHARGEV
Download sequence
Identical sequences E1BJ55
ENSBTAP00000017001 ENSBTAP00000017001 NP_001179293.1.59421 NP_001179293.1.76553 XP_010813377.1.76553 XP_019835709.1.53367 XP_019835710.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]