SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017099 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017099
Domain Number 1 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 491-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 7 Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000231
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 296-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000213
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 9 Region: 125-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000118
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017099   Gene: ENSBTAG00000012868   Transcript: ENSBTAT00000017099
Sequence length 546
Comment pep:known chromosome:UMD3.1:7:22051621:22085201:-1 gene:ENSBTAG00000012868 transcript:ENSBTAT00000017099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEDVAVNFTLEEWALLDPGQRKLYRDVMLETCRNLASVVLNLYMVKTRSSTQCDI
LKNELCSEEKKVRFPRNDSWSVFGENWMFLDIGGHQTLERDWRNHLVEKLCIDNEGHHCL
EALNQITDLTLHKGYWPGIQPCKCTKCGKAYRGCSFQNQQKSLPGYRHYPCEECGEACSC
VSCLSPPRGTDIVEEPNKCQDAGRTCKRCVKSHDCKKSGKALAFPSSFKGHERGQHGQKT
HTCKVCGKSFSYHSYLARHMRTHTEEKHCECEKCGKAFSCPKYFRRHMKTHSGMKPYECT
ECGKAYSSSLSLREHAGTHSQEKPYECQHCGKAFSCSMSLQEHERTHTGEKPFGCPFCGK
AFIYYCQLKRHVRTHTGEKPYKCKECGKAFTGISHFREHVRMHTGEKPYECKQCGKAFSW
CTYLREHMRTHSGEKPYECKQCGKAFPYLKSLQGHVRIHTGEKPYVCNDCGKSYSCPKYF
RKHVKTHSGVKPYECTECRKAFITSSSLREHMKTHSEEKPYQCQQCGKAFRYPRSLQGHM
ITHSEE
Download sequence
Identical sequences F1MCP1
ENSBTAP00000017099 ENSBTAP00000017099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]