SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017129 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017129
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 170-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017129   Gene: ENSBTAG00000012889   Transcript: ENSBTAT00000017129
Sequence length 533
Comment pep:known chromosome:UMD3.1:24:5357673:5459491:1 gene:ENSBTAG00000012889 transcript:ENSBTAT00000017129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYGRSLFHILDFVKILSQGCGTKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPE
GIVESIQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKAGLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASVLTEMPPQPIKPLIPPMNRRNILVMKH
NYSQEAADACDIDEIEEVPTTSHRLSRHEKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences E1BGQ7
ENSBTAP00000017129 ENSBTAP00000017129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]