SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017164 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017164
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 4-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 4 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 7 Region: 114-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 449-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000229
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017164   Gene: ENSBTAG00000012915   Transcript: ENSBTAT00000017164
Sequence length 497
Comment pep:known chromosome:UMD3.1:18:52395545:52400150:1 gene:ENSBTAG00000012915 transcript:ENSBTAT00000017164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSFQMPLTFSDVSIDFSQEEWECLNSDQKNLYRDVMLETYTNLVSLDFDFTTENNKLS
SEKSSFEVNSYHWEIMKSKTFNLMGFIFRNDSQSRNQFEGQQASQVEHFSQMIFQKHISL
PLHQRIHTKEKSCECKECRKGFRKYSHLTENLRDHSGVRPYECRECGKAFPVLQHFIRHK
KSHTDLKSYECNGCEKAFRLYSQLIQHQIIHTGVKPYKCKQCGKAFRRHSHLTKHQNIHV
GLKPYKCKECGETFRFYRHMCLHQKIHHGVKPYICKECGKAFGHHSSLYQHKKIHSGEKP
YKCKQCGKAFVYSYLLTEHQRSHTGEKPHECKECGKAFSRASSLLRHKRIRSGEKHYDCK
ECGKAFCRVYQFTQHQRIHTGEKPHECKECGKTFKLHSYLIKHQIIHSDLKPYECKHCGK
AFNRVGNLKMHESIHTGEKPYECKECGKTFRLNSKLNYHQAVHTGLKPYICKECKKAFRS
ISGLSQHKRIHTGEKTL
Download sequence
Identical sequences F1MHG2
9913.ENSBTAP00000017164 ENSBTAP00000017164 ENSBTAP00000017164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]