SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017284 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017284
Domain Number 1 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 680-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000406
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 586-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000163
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000017284
Domain Number - Region: 416-544
Classification Level Classification E-value
Superfamily SET domain 0.000245
Family Histone lysine methyltransferases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017284   Gene: ENSBTAG00000012999   Transcript: ENSBTAT00000017284
Sequence length 798
Comment pep:known chromosome:UMD3.1:5:71324566:71347630:-1 gene:ENSBTAG00000012999 transcript:ENSBTAT00000017284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEMNLSPVGMEQLTSSSVSNALPVSGSHLGLAASPTHNAIPAPVGLPVAIPNLGPSLSS
LPSALSLMLPMGIGDRGVMCGLPERNYTLPPPPYPHLESSYFRTILPGILSYLADRPPPQ
YIHPNSINVDGNTALSIANNPSALDPYQSNGNVGLEPGIVSIDSRSVNTHGAQSLHPTDG
HEVALDTTITMENVSRVTSPISTDGMAEELTMDGVAGEHTQIPNGSRSHEPLSVDSVSSN
LAAETVGHGGVIPMHGNGLELPVVMETDHIASRVNGMSDSALSDSIHTVAMSTNSVSVAL
STSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVPPSLQMEDSN
SNKENMATLFTIWCTLCDRAYPSDCPDHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGA
DVGVWTGETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENE
CNWMMFVRKARNREEQNLVAYPHDGKIYFCTSQDIPPENELLFYYSRDYAQQIGVPEHPD
VHLCNCGKECSSYTEFKAHLSSHIHNHLPSHGHSSSHGPSHSKERKWKCSMCPQAFISPS
KLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLES
HMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNS
HEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAQEEEEEDDSEEEELVDSVGTED
CRIGSAVYSADDSLSAHK
Download sequence
Identical sequences E1BDK1
9913.ENSBTAP00000017284 ENSBTAP00000017284 ENSBTAP00000017284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]