SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017348 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017348
Domain Number 1 Region: 287-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-40
Family variant C2H2 finger 0.02
Further Details:      
 
Domain Number 2 Region: 211-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-17
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017348   Gene: ENSBTAG00000013050   Transcript: ENSBTAT00000017348
Sequence length 455
Comment pep:known chromosome:UMD3.1:4:55994119:56128665:-1 gene:ENSBTAG00000013050 transcript:ENSBTAT00000017348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPKTQGAATQGEDSDGNRGGAGGVSYEDTKDYILEPLSLPESPGGTTSLEGSPSVPCI
FCEEHFPVVEQDKLLKHMIIEHKIVIADVKLVADFRRYILYWRKRFTEQPITDFCSVIRI
NCTAPSEEQDNYFLLCDVLPEDRILREELQKQRLKEILEQQQQERNDNSFRGICMFCNEE
FLGNRSILLNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKD
HMRKKQHRRINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLEHQEDDWSDWEEHPVS
AVCLFCEKQAETIEKLCVHMEDAHEFDLLKIKSELGLNFYQQVKLVNFIRRQIHQCRCYG
CQEKFRSKADLRTHMEEAKHTALLPEKQIWDQPQYYFPTYENDTLLCTLSDSESDLTAQE
QNGNIAIISEDTSKLHALKQSSILNQLLLHESLKN
Download sequence
Identical sequences F6Q3F4
ENSBTAP00000017348 ENSBTAP00000017348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]