SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017459 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017459
Domain Number 1 Region: 65-240
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.83e-43
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017459   Gene: ENSBTAG00000013133   Transcript: ENSBTAT00000017459
Sequence length 353
Comment pep:known chromosome:UMD3.1:29:45942347:45947879:1 gene:ENSBTAG00000013133 transcript:ENSBTAT00000017459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALGEDLAQPGELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSAAEPGPGHPPADLI
RQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQ
NLAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQ
GPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPRVHKH
LQKVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEALHWTGRGAEAQNEKACVRLS
AALGSWQAALPTSVRGCWDLLAGAPKWPTCSQSRQQSCRRVEGVWPRTGSGPG
Download sequence
Identical sequences A6QQB2
ENSBTAP00000017459 NP_001095530.1.59421 NP_001095530.1.76553 ENSBTAP00000017459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]