SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017461 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017461
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily EF-hand 4.12e-23
Family Calmodulin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017461   Gene: ENSBTAG00000013136   Transcript: ENSBTAT00000017461
Sequence length 142
Comment pep:known chromosome:UMD3.1:10:102666363:102692145:-1 gene:ENSBTAG00000013136 transcript:ENSBTAT00000017461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCSQAGARPRTWEASPPEHKKWVEVFKACDEDNKGYLSREDFKVAVVMLFGYKPSKIEA
DSVMSSVDPNTSGIRLKEFLDIVRKKKEAQLYRNEVRHIFTAFDRHYRGYLTLEDFKKAF
KQVAPKLSERIILEVFSDVLAR
Download sequence
Identical sequences E1BIY4
ENSBTAP00000017461 ENSBTAP00000017461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]