SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017574 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017574
Domain Number 1 Region: 155-493
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.92e-120
Family Mammalian PLC 0.000000158
Further Details:      
 
Domain Number 2 Region: 4-154
Classification Level Classification E-value
Superfamily EF-hand 7.6e-40
Family EF-hand modules in multidomain proteins 0.0026
Further Details:      
 
Domain Number 3 Region: 511-633
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-28
Family PLC-like (P variant) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017574   Gene: ENSBTAG00000013202   Transcript: ENSBTAT00000017574
Sequence length 634
Comment pep:known chromosome:UMD3.1:5:91771436:91820146:1 gene:ENSBTAG00000013202 transcript:ENSBTAT00000017574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKWFLLMVRDDFKGGKITLEKALKLLEKLDIQCNTIHVKYIFKDNDRLKQGRITIEEF
RTIYRIITYREEIIEIFNTYSENRKILLEKNLVEFLMREQYTLDFNKSIASEIIQKYEPI
EEVKQAHQMSFEGFRRYMDSSECLLFDNKCDHVYQDMTHPLTDYFISSSHNTYLISDQLW
GPSDLWGYISALVKGCRCLEIDCWDGSQNEPVVYHGYTFTSKLLFKTVIQAINKYAFLAS
EYPVVLSLENHCSPSQQEVMADSLLATFGDALLSYTLDNFSDRLPSPEALKFKILVRNKK
IGTLHETLERKGSDMHGKVEEFEEEEEIEQEEDGSGAKEPEPVGDFQDDLAKEEQLKRVV
GIPLFRKKKIKISMALSDLVIYTKVEKFKSFHHSHLYQQFNESNSIGESQARKLTKLAAR
EFILHTRRFITRVYPKALRADSSNFNPQEFWNVGCQMVALNFQTPGVPMDLQNGKFLDNG
CSGYVLKPRFLRDKKTKFNPHKVQIDSNPLTLTIRLISGIQLPPSYQNKADTLVIVEIFG
VPNDQMKQQSRVIKKNAFNPRWNETFTFVIQVPELALIRFVAENQGLIAGNEFLGQYTLP
VLCMNRGYRRVPLFSKMGESLEPASLFIYVWYIR
Download sequence
Identical sequences Q1RML2
ENSBTAP00000017574 NP_001011680.2.59421 NP_001011680.2.76553 XP_010854220.1.44457 ENSBTAP00000017574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]