SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017600 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017600
Domain Number 1 Region: 184-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 156-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000288
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 3 Region: 226-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000989
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 126-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000597
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017600   Gene: ENSBTAG00000013227   Transcript: ENSBTAT00000017600
Sequence length 268
Comment pep:known chromosome:UMD3.1:14:21577309:21580910:-1 gene:ENSBTAG00000013227 transcript:ENSBTAT00000017600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHFNASKKPNYSELDTHTVIISPCLYEGYPVPVIPQPEVLRSGAYSPIAVWT
TASPFHAPLPAGLSPLSGYPASLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLGKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCSHCSRAFADRSNLRAHLQTHSDVKK
YQCKSCSKTFSRMSLLHKHEESGCCAAH
Download sequence
Identical sequences A0A212CEC6 L8IV67 Q3MHQ4
NP_001029710.1.59421 NP_001029710.1.76553 XP_005892048.1.15283 XP_006063483.1.26621 XP_010837246.1.44457 XP_019829577.1.53367 XP_020731799.1.74333 ENSBTAP00000017600 ENSBTAP00000017600 9913.ENSBTAP00000017600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]