SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017662 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017662
Domain Number 1 Region: 443-521
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000335
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017662   Gene: ENSBTAG00000013281   Transcript: ENSBTAT00000017662
Sequence length 696
Comment pep:known chromosome:UMD3.1:2:136276529:136314563:1 gene:ENSBTAG00000013281 transcript:ENSBTAT00000017662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGNTQMYVEDRIEAPGARPSPGLRTASDRAGDEPTTSEVCQAVFPDAEAMDSGPQPAP
ALGALETGPGHRDASEEGFPQLSPQEQKPPAGPGTKLSSWVPQEGRRELQAHQDLATPGS
ELGVPPNGVPVTQKGLQQQGSGKETEDQQGSQQNPEPVEGQGPESRQGLGFSFTLTSESD
TVQPTEPYCTLDSCEQQLEDKPPKEVDTPPIGPQRALPEPGPGGCEDSSQEEVSLMPTAT
LEEKTVHTAPPPRPRSDTPKARDEAVEIQPTLGPARPPEAVDTGARGLDPTQKQPQEPAA
ATGARDPGSARPGFMRRLLEVEEEEAALRRAAKARALPGRRCPRALGPVPAPAPSLPPPL
PAAQAPASASARAWARPPVPAPVPAPAGTPGPAPGPAAVLPVPASDLAWRRTELLSHSRE
RSLKARQELEERCLLNVCQTWEERAEEHLTMKQEEAFRSYFEIFNGHGEVDAQSLENILL
LVGISLTTAQVEGALRSADIDGDGHVNFKDFLTVMTDTRRFFCSVEQNALMDMAPPNPDT
LFFEILSLLVEMLALPEGALEEITSYYQRKLKEGACKARETESATGRLRPRKKLPYSPPQ
ADTLEIPERRVLRVLSRLKQQNYAANLQSPYAQVPCIPLCPRLDKKTVRRKQGGHYELEQ
CPSPGLGPDIHSILLHTGSQGGREPGRLSSVPARTH
Download sequence
Identical sequences E1BE70
ENSBTAP00000017662 ENSBTAP00000017662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]