SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017670 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017670
Domain Number 1 Region: 67-187
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.19e-26
Family Frizzled cysteine-rich domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017670   Gene: ENSBTAG00000013287   Transcript: ENSBTAT00000017670
Sequence length 780
Comment pep:known chromosome:UMD3.1:4:93922581:93946896:1 gene:ENSBTAG00000013287 transcript:ENSBTAT00000017670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARLARGPELLLLGLLLLLGGPGRGAALSGNATRPGPWSAGGSARRSAAVTGPPPLLS
HCGRAAPCEPLRYNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVI
QPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEV
QNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTG
LCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMR
LGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHL
LTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRG
VMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWER
SFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGISMSTWVWTKATL
LIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAG
LAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEKANLWLVEAEIS
PELEKRLGRKKKRRKRKKEVCPLVPPPELHLPALGPASASSAVPRLPQLPRQKCLVAAGA
WGPGESCRPGAWTLVSNPFCPEPSAPAPVAWAQGRRQGLGPIHSRTNLMEAELMDADSDF
Download sequence
Identical sequences E1BE57
ENSBTAP00000017670 ENSBTAP00000017670 NP_001179149.1.59421 NP_001179149.1.76553 9913.ENSBTAP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]