SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017724 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017724
Domain Number 1 Region: 157-421
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 2.09e-102
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000000532
Further Details:      
 
Domain Number 2 Region: 4-140
Classification Level Classification E-value
Superfamily SNARE-like 6.1e-42
Family Clathrin coat assembly domain 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017724   Gene: ENSBTAG00000013329   Transcript: ENSBTAT00000017724
Sequence length 423
Comment pep:known chromosome:UMD3.1:7:7820650:7850254:-1 gene:ENSBTAG00000013329 transcript:ENSBTAT00000017724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
Download sequence
Identical sequences A0A024R7K8 A0A0A0MXC6 A0A0D9R0D8 A0A287AHA6 A0A2J8T6R5 A0A2K5C605 A0A2K5I9X9 A0A2K5NQG1 A0A2K5QCX3 A0A2K5VBK5 A0A2K5ZHD6 A0A2K6FWI5 A0A2K6LCW1 A0A2K6NPA9 A0A2K6U0Z4 F7AVN6 G2HJF4 G3SK90 H0XEJ0 I3MR98 J9P1I0 L5LL49 M3WAM2 Q2KJ81 Q9BXS5 S7NVL4 U3EUE9 W5NPI3
NP_001039349.2.59421 NP_001039349.2.76553 NP_001233313.1.37143 NP_001244467.1.72884 NP_115882.1.87134 NP_115882.1.92137 XP_002828903.1.23681 XP_003796568.1.62490 XP_003813605.1.60992 XP_003982072.1.62641 XP_004060272.1.27298 XP_004277654.1.21590 XP_004384484.1.4749 XP_004404639.1.74151 XP_004423058.1.5094 XP_004666023.1.11716 XP_004688710.1.23501 XP_004761141.1.14098 XP_005279111.1.60341 XP_005333098.1.77405 XP_005588379.1.63531 XP_005856742.1.60319 XP_005901525.1.15283 XP_006057890.1.26621 XP_006099715.1.53796 XP_006174840.1.101512 XP_006199164.1.17985 XP_006736132.1.47382 XP_006768510.1.95426 XP_006877167.1.41390 XP_006898343.1.29581 XP_006904310.1.64745 XP_007105036.1.24612 XP_007461048.1.90284 XP_007943502.1.48129 XP_007993829.1.81039 XP_008156042.1.99482 XP_008247547.1.1745 XP_008585764.1.73410 XP_009433174.1.37143 XP_010328423.1.74449 XP_010359797.1.97406 XP_010843895.1.44457 XP_010970391.1.22495 XP_010993359.1.51371 XP_011365191.1.92234 XP_011808651.1.43180 XP_011835994.1.47321 XP_011949658.1.92194 XP_011984292.1.54773 XP_012325294.1.9421 XP_012519038.1.63892 XP_014721370.1.49734 XP_016013256.1.101085 XP_016064854.1.3490 XP_017356663.1.71028 XP_017749177.1.44346 XP_017906822.1.57651 XP_019271719.1.44245 XP_019271720.1.44245 XP_019497622.1.44202 XP_019592434.1.88060 XP_019652587.1.58354 XP_019819489.1.53367 XP_020764309.1.74333 XP_021538834.1.83697 XP_852486.1.84170 ENSPVAP00000009199 ENSCAFP00000039404 ENSSSCP00000014730 gi|14210504|ref|NP_115882.1| ENSMMUP00000018433 ENSMMUP00000018433 9544.ENSMMUP00000018433 9598.ENSPTRP00000018166 9600.ENSPPYP00000010856 9823.ENSSSCP00000014730 9913.ENSBTAP00000017724 ENSOGAP00000014367 ENSPANP00000014817 ENSSTOP00000014586 ENSBTAP00000017724 ENSBTAP00000017724 ENSP00000291439 ENSPVAP00000009199 ENSSSCP00000014730 ENSSTOP00000014586 ENSOARP00000000073 ENSOGAP00000014367 ENSP00000291439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]