SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017861 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017861
Domain Number 1 Region: 219-521
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.69e-90
Family Arginine methyltransferase 0.0000000000845
Further Details:      
 
Domain Number 2 Region: 30-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-35
Family variant C2H2 finger 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017861   Gene: ENSBTAG00000013421   Transcript: ENSBTAT00000017861
Sequence length 527
Comment pep:known chromosome:UMD3.1:29:24684060:24806790:-1 gene:ENSBTAG00000013421 transcript:ENSBTAT00000017861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLASGATGAAEEEDPPGLSDSGDEASWEDEDDADLPHAEQQTPCLFCDRLFTSAEETF
SHCKLEHQFSIDNMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPV
LEDDLLLQFDVEDLYEPVSVPFSYPNGLSENASLLEKLKHMETRALSAEAALAGAREDLQ
KMKQFAQDFVMNADVRACPSSTTAIADLLEDEDGVYFSSYGHYGIHEEMLKDRVRTESYR
DFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLED
TVTLIKGKIEEVRLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICT
ISLVAVSDMNKHADRIAFWDDVYGFNMSCMKKAVIPEAVVDILDPKTLISDACSIKHIDC
HTTSVSDLEFSSDFTLKITETSLCTAIAGYFDIYFEKNCHNKVVFSTGPLSTKTHWKQTV
FLLEKPFSVKAGEALKGKITVHKNKKDPRSLIVALTLNNTTQTYGLQ
Download sequence
Identical sequences A6QL80
ENSBTAP00000017861 ENSBTAP00000017861 NP_001095546.1.59421 NP_001095546.1.76553 XP_019810594.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]