SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017903 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017903
Domain Number 1 Region: 192-306
Classification Level Classification E-value
Superfamily POZ domain 7.85e-26
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000236
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 879-931
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000746
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 649-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000106
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 764-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 564-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000706
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number 7 Region: 820-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000991
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000017903
Domain Number - Region: 920-955
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.0249
Family Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017903   Gene: ENSBTAG00000013460   Transcript: ENSBTAT00000017903
Sequence length 1052
Comment pep:known chromosome:UMD3.1:1:46382671:46412050:-1 gene:ENSBTAG00000013460 transcript:ENSBTAT00000017903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEESYQAILRYLTNECEPYAPGTEGNVKRKIRKAAACYVVRDGTLYYQRRQRHRKTFA
ELEVVLQPERRRGLIEAAHLGPGGTHHTQHQTWHDLSKTYWWRGILKQVKDYIKQCSKCQ
EKLDRSRPISDASEMLEELGLDLESGEESNESEDDLSNFTSPPTTASKPVKKKPVSKHEL
VFVDTRGVVKRSSPKHCQAVLKQLNEQRLSNQFCDVTLLIEGEEYKAHKSVLSANSEYFR
DLFIEKGAVSSHEAVVDLSGFCKASFLPLLEFAYTSVLSFDFCSMADVAILARHLFMSEV
LEICESVHKLMEEKQLTVYKKGEVQTVASTQDLQEQSGGTAPPVANNTGTTTTLSTELGD
CEIVLLMNGELPEQNGELGQQPEPQVSSQAEATASPVGCVTDSHPEMESVDLVTKNNQTE
LETLNSREDSTVSSTHPKLSQENVISSSPGNTDTGNDTAAEDICAEDISEHRQDLDPSSK
DEENLAEPTALMDQSPDDDTYRSRLRQRSVNEGGYIRLHKGMEKKLQKRKAIPKSAVQQV
AQKLVQRGKKMKQPKRDAKENTEEEASHKCGECGMFFQRRYALIKHILKHERARDYKCPL
CKKQFQYSASLRAHLIRHTRKDAPTSSSSSSASNEASGSSSEKGRTKREFICSICGRTLP
KLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRS
LQEHMSIHTGESKYLCSVCGKSFHRGSGLSKHLKKHQPKPEVRGYHCTQCEKSFFEARDL
RQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHV
KKATHGKKGRAKQNLERVCEQCGRKFTQLREYRRHMNNHGGVKPFECLTCGVAWADARSL
KRHVRTHTGERPYVCPVCSEAYIDARTLRKHMTKFHRDYVPCKIMLEKDTLQFHNQGTQV
EHAVSILTADMQEQENNGPQELETVVVTGETMEALEAVAATEECPSVSTLSDQSIMQVVN
YVLAQQQGQKLSEVAEAIQTVEVEVAHISETE
Download sequence
Identical sequences E1BBI5
9913.ENSBTAP00000017903 ENSBTAP00000017903 NP_001192485.1.59421 NP_001192485.1.76553 ENSBTAP00000017903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]