SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018075 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018075
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000538
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018075
Domain Number - Region: 184-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00525
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018075   Gene: ENSBTAG00000002398   Transcript: ENSBTAT00000018075
Sequence length 647
Comment pep:known chromosome:UMD3.1:18:47089349:47118008:-1 gene:ENSBTAG00000002398 transcript:ENSBTAT00000018075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSVSFKDVTVDFSQEEWQHLDPAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLER
GEEPWTSFKGHTCLEENWKAEDFLLKFKEQQDKYSRSVILINHKKLVNENGSTCEKTLTL
SKNPINSKKLPPEYDTREKILKNVSELIISNLSPTRRRLSECNGYGKSLLNTKPETAHSG
VKSHNQCGRTISHNEKITQYHKMETPAQSFEYNDCEKAFLKRGGPVTHSRTYRRGNTSDY
NKRRRTTNIEKKHTCTECGKSFCRKSVLILHQGIHTEEKPYQCHQCGNSFRRKSYLIDHQ
RTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECPQCRNAFRLKSHLIRHQRTHT
GEKPYECSDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKP
YICNECGKSFSQKTTLALHEKTHNEEKPYICNECGKSFRQKTTLVAHQRTHTGEKSYECP
HCGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICNECGK
SFRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCSECGKCFRQ
KTNLIVHQRTHTGEKPYICNECGKSFSYKRNLIVHQRTHKGENMEMQ
Download sequence
Identical sequences F1MTT8
XP_005219030.1.76553 XP_010813072.1.76553 XP_010813074.1.76553 XP_010813075.1.76553 9913.ENSBTAP00000018075 ENSBTAP00000018075 ENSBTAP00000018075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]