SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018136 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018136
Domain Number 1 Region: 22-130
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.27e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 319-364
Classification Level Classification E-value
Superfamily RING/U-box 0.000000864
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 255-292
Classification Level Classification E-value
Superfamily SAP domain 0.0000565
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018136   Gene: ENSBTAG00000013645   Transcript: ENSBTAT00000018136
Sequence length 370
Comment pep:known chromosome:UMD3.1:19:15378253:15400325:1 gene:ENSBTAG00000013645 transcript:ENSBTAT00000018136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSPCLWRQASDLIMWATCCNWFCLDGQPEEASPPQGARTQAYSNPGYSSFPSPTGSEPS
CKACGTHFASMARKQTCLDCKKNFCTSCSSQVGAGPRLCLLCQRFRATDFRREELMKMKV
KDLRDYLSLHDISTDMCREKEELVSLVLGQQPVISQEGRTQAPHLGPDFPEQQAFLARPH
TSTVPPTSPGLQSAPPGQAQGRQQANGHVSQDQEEPIYLERTARAPAEDETQSVDSEDSF
VPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQ
HLVCSAEDQNGGAVPSSLEENLCRICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQY
VIRAVHVFRS
Download sequence
Identical sequences F1MII9
ENSBTAP00000018136 ENSBTAP00000018136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]