SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018206 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018206
Domain Number 1 Region: 771-951
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.26e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 926-1044
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 160-192,228-374
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-31
Family Phosphotyrosine-binding domain (PTB) 0.0055
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-20
Family Phosphotyrosine-binding domain (PTB) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018206   Gene: ENSBTAG00000013699   Transcript: ENSBTAT00000018206
Sequence length 1165
Comment pep:known chromosome:UMD3.1:6:58848558:59065295:1 gene:ENSBTAG00000013699 transcript:ENSBTAT00000018206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
TKPVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQRVHKLIHNSHDPSYFACLIKN
DAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VAVAHRKAPPALIDECIEGFSHVSGGFSSDQSRSALQPPGDGERGPRPMRKSFSQPGLRS
LAFRKEFQDAGLRSSSFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLI
SPDTKKIALQKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDEI
MMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTTLTN
QEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKVHIHIGEIKQTSQIAAENIGSE
LPSSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSVSSMFSNTSK
EPSGYEKEALPISESCFRLLGSSDDLSSDSESQLTEEPALLSPKQGFRRRANTLSHVPVE
CQEPPQLVRGSPGVSQRKLVRYHSVSTETPHERKDFESKADHISDASRTPVKTRRHSWRQ
QIFLRVATPQKACESPKRYEDYSELGELPPRSPLEPVCEDGPFGPVPEEKKRTSHELREL
WQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKILSTPGR
SKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQYHLKHPFPCKQQPKDTPYKELLKQLTS
QQHAILIDLGRTFPTHPYYSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLH
MGEEEAFNMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPS
LYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIV
DFIKSTLPNLGLVQMEKTISQVFETDISKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKL
EKTNSSLRKQNLDLLEQLQVANGRIQSLEATVEKLLTSESKLKQATLALELERSALLQTV
EQLRRQTAELGSQESDPTLPKPSGD
Download sequence
Identical sequences O97790
ENSBTAP00000018206 NP_001159996.1.59421 NP_001159996.1.76553 XP_005207895.1.76553 ENSBTAP00000018206 9913.ENSBTAP00000018206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]