SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018279 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018279
Domain Number 1 Region: 551-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.00064
Further Details:      
 
Domain Number 2 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 302-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000189
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000985
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 436-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000307
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 7 Region: 467-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000607
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018279   Gene: ENSBTAG00000013757   Transcript: ENSBTAT00000018279
Sequence length 727
Comment pep:known chromosome:UMD3.1:18:35270360:35290823:1 gene:ENSBTAG00000013757 transcript:ENSBTAT00000018279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGAVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPVICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN
QPKQTQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEM
ILSMMDR
Download sequence
Identical sequences Q08DH9
ENSBTAP00000018279 NP_001069216.1.59421 NP_001069216.1.76553 XP_004015120.1.66739 XP_004015121.1.66739 XP_005218651.1.76553 XP_005218653.1.76553 XP_005896604.1.15283 XP_005896605.1.15283 XP_005959211.1.78601 XP_005959212.1.78601 XP_005959213.1.78601 XP_006072091.1.26621 XP_006072092.1.26621 XP_006072093.1.26621 XP_006072094.1.26621 XP_010812784.1.76553 XP_010849333.1.44457 XP_010849334.1.44457 XP_010849335.1.44457 XP_011965919.1.54773 XP_011965920.1.54773 XP_011965921.1.54773 XP_011965922.1.54773 XP_012045352.1.66739 XP_014961971.1.54773 XP_017917648.1.57651 XP_017917649.1.57651 ENSBTAP00000018279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]