SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018380 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018380
Domain Number 1 Region: 25-141
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000234
Family Shikimate kinase (AroK) 0.063
Further Details:      
 
Domain Number 2 Region: 24-57,169-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000664
Family Shikimate kinase (AroK) 0.074
Further Details:      
 
Domain Number 3 Region: 384-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000744
Family HkH motif-containing C2H2 finger 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018380   Gene: ENSBTAG00000013832   Transcript: ENSBTAT00000018380
Sequence length 467
Comment pep:known chromosome:UMD3.1:3:106806510:106851446:1 gene:ENSBTAG00000013832 transcript:ENSBTAT00000018380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAARAVSVGPGLQSLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRLCQHHMISFVDPLVMNYTVVDFRNKATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNAKPQEMGTEKVIDRKVELEKEDGHVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHAEEGGGPLGGPLKFPNPCILWLHAEQTVLDERL
DKRVDNMLAAGLLDELRDFHKRYNEKKVAENGQDYQHGIFQSIGFKEFHEYLITEGKCTP
EIRNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGTSVPPVYGLEVSDVSKWEESVL
EPALEIVRSFIQGHKPAATPVKMPGSETENKRSYHMCELCDRIIIGDREWAAHMKSKSHL
HQLKKRRRLDSDAVTTVESQSVSPDHDKELKEKESLGQNDKELKASI
Download sequence
Identical sequences F6RA00
ENSBTAP00000018380 NP_001179769.1.59421 NP_001179769.1.76553 ENSBTAP00000018380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]