SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018399 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018399
Domain Number 1 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 3 Region: 184-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 240-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 398-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 148-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000854
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 447-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000729
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018399   Gene: ENSBTAG00000018094   Transcript: ENSBTAT00000018399
Sequence length 500
Comment pep:known chromosome:UMD3.1:25:27014540:27018793:-1 gene:ENSBTAG00000018094 transcript:ENSBTAT00000018399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSAPLPARGPGEARPGRRRGRRPRAVKFGDVALYFSREEWGCLRPAQRALYRDVMQE
TYGHLGALGCAGPKPALISWLERNTDDWETAALDPQECPKGVAVQRKTRKKNEEKEVFPP
KEAPRKGKRGRRPSKPRLIPRQTSGSPICPDCGCTFPDHPALQRHKCAQNLKKPYPCPDC
GRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCF
RRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYPCLECNRRFRQRT
ALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHQRVHSGERPYACEHCEARFSQRSTLLQ
HQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTKEKEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCIPG
VQNCGPRSAIGAPSQKGQAL
Download sequence
Identical sequences A4IFR4 L8IZL1
9913.ENSBTAP00000018399 ENSBTAP00000018399 NP_001077215.1.59421 NP_001077215.1.76553 XP_005888865.1.15283 XP_006070490.1.26621 ENSBTAP00000018399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]