SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018471 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018471
Domain Number 1 Region: 38-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 152-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 262-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.96e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 204-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-17
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000064
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018471   Gene: ENSBTAG00000013906   Transcript: ENSBTAT00000018471
Sequence length 360
Comment pep:known chromosome:UMD3.1:19:26949113:26950507:1 gene:ENSBTAG00000013906 transcript:ENSBTAT00000018471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPHICHEYGKDFNQSSNLVDMRIHNGENPYECKECGKAFKGSSNLVLHQRIHTGEKPYVF
NECGKAFNQSSDLIIHHRTHTGEKPYKCYECGQTFSQSSHLVTHQRIHTGEKGFKGSNCE
KTFRQCSHLTEHQRHSGERPHECCKCGKSFRSSDLIRHWITHTGEKPYECSECGKAFGQR
SHLMTHQKSHTGEKPYQCNECAKAFRQRSLLIQHHRIHSGEKPSYQCIQCGRTFWGSSDL
TRHQITHSGEKPHEYKECGKTQSSDLMQHHRIHSGEKPNVCNKCGKSFRDSSDLIKHHCV
HTGEKPYECSECKKAFCQNSHLVSHQRIHTGEKAFECSHCGKAFSRHTAFLKHQKLHTGK
Download sequence
Identical sequences F1MK93
ENSBTAP00000018471 ENSBTAP00000018471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]