SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018632 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018632
Domain Number 1 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 180-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000202
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 456-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000369
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 4 Region: 114-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000759
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018632   Gene: ENSBTAG00000014016   Transcript: ENSBTAT00000018632
Sequence length 515
Comment pep:known chromosome:UMD3.1:4:5424474:5494384:-1 gene:ENSBTAG00000014016 transcript:ENSBTAT00000018632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRCEQDAQSGKESPPVSDTPDDSDEPMPVPEDLSTTSGGQQSSKSERGLAGNVKVETQS
DEENGRACEVNGEECAEDLRMLDASGEKMNGSHSVQGSKALSGAGGIRLPNGKLKCDVCG
IICIGPNVLMVHKRSHTERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRR
RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLQSMGLPGTLYPVIKEET
NHSEMAEDLCKMGSDRSLVLDRLASNVAKRKSSMPQKFVGDKCLSELPYDGSASYEKENE
MMQTHVMDQAINNAISYLGAESLRPLVQTPPGSSDVVPVLSPMYQLHKPHGEGPARSNHS
AQDGAVENLLLLSKAKSASSEREASPSNSCQDSTDTESNTEEQRGGLIYLTNHINPHARN
GLSIKEEHAAYDVLRAASEGPPDALRVIGTSGEALKVYRCEHCRVLFLDHVMYTIHMGCH
GFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Download sequence
Identical sequences E1BAW6
9913.ENSBTAP00000018632 NP_001098727.1.59421 NP_001098727.1.76553 ENSBTAP00000018632 ENSBTAP00000018632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]