SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018782 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018782
Domain Number 1 Region: 671-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000111
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 637-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000249
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 759-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000082
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018782   Gene: ENSBTAG00000014123   Transcript: ENSBTAT00000018782
Sequence length 954
Comment pep:known chromosome:UMD3.1:18:43038546:43068295:1 gene:ENSBTAG00000014123 transcript:ENSBTAT00000018782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGSSVAMLVSDIGEQEAMLTAKTVISSSLEIDEQRKAKTDPLIHVIQKLSKIVEHEKS
QKCLLIGKKRPRSSAAAHSLLESQESCEIPAKVTQSPATDIRRAEMSQIHFTPDSPAQSD
GKAMSYQCSLCKFLSSSFSVLKDHIKQHGQQNEVILMCAECHITSKSQEELEAHVVNDHE
NDANSHTQSKAQQCISPTNPLCHQTSERKNETIPDIPASVDNLQTHTVQTASVAEIGKRK
WYAYEQYGMYRCLFCSYTCGQQRMLKTHAWKHAGEVDCSYPIFENENEPLGLLDSSVAAA
PSGVHAVVIAIGDNELSIHNGPSVQVQICSSEPLSSSSPLEQSAEGGVHLSQSVTLDPNE
EEMLEVISDAEESLVGDSLLSSAQKIISSSPNKKGHVNVIVERLPSAEETLSQKHFLMNA
EIEEGKSLSPAEAKLVCEGRGEVYHADKCTVDIGGLIIGWGNSEKKDSELINKGLATDEN
APPGRRRTNSESLRLHSLAAEALVTMPIRAAELTRTNLGHYGNINLLDPDTGQRQVDGAV
AAYSKMMSPLKNSPEGLASFNQSNSTLVALPEGRQELADGQVKTGISMSLLTVIEKLRER
TDQNASDDDILKELQDNAQCQPNSDASLSGSSVVEYIPNAERPYRCRLCHYSSGNKGYIK
QHLRVHRQRQPYQCPICEHIADNSKDLESHMINHCKTRIYQCKQCEDSFHYKSQLRNHER
EQHSLPDTLSIATSNESRISSDKTDGKCVQEGNKSSVQKQYRCDVCDYTSTTYVGVRNHR
RIHNSDSLTGKCSLCGYVCSHPPSLKSHMWKHASDQNYNYEQVNKAINDAISQSGRIRGK
SSGKMVLNSNEERADSLTSGSSENLVSSSELIPQAPNEVRGPNENEKLSPASNTSKNSSL
APPGVEYCVLLFCCCICGFESTSKENLLDHMKEHEGEIVNIILNKDHNTTLNTN
Download sequence
Identical sequences F1MNI3
ENSBTAP00000018782 ENSBTAP00000018782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]