SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018862 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018862
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018862   Gene: ENSBTAG00000014186   Transcript: ENSBTAT00000018862
Sequence length 406
Comment pep:known chromosome:UMD3.1:13:75518488:75534491:-1 gene:ENSBTAG00000014186 transcript:ENSBTAT00000018862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAPSRPSPTRRDPYGFGDSRDTRRDRSPIRGSPRREPRDGRNGRDARDGRDMRDPRDL
RDHRDSRDIRDHRDSRSMRDARDMRDLRDFRDLRETRNFRDHRDPMYDRYREMRDSRDPI
LRREGSYDRYLRMDDYCRRKDDAYFDRYRDSFDGRGPPGPESQSRVKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPEEGMRGGHPPAIQSLLNLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGELRGRAEARFPVNHSGRPRVPH
Download sequence
Identical sequences F1MM36
ENSBTAP00000018862 ENSBTAP00000018862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]