SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018899 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018899
Domain Number 1 Region: 127-198
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-22
Family Homeodomain 0.0000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018899   Gene: ENSBTAG00000014217   Transcript: ENSBTAT00000018899
Sequence length 271
Comment pep:known chromosome:UMD3.1:26:14120258:14126068:1 gene:ENSBTAG00000014217 transcript:ENSBTAT00000018899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYPHPGPATAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPTPTLPSPNSSF
TSLVSSYRAPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRSVNDYTHALLRHD
PLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSE
RQVKTWFQNRRAKWRRLKQENPQNNKKEELESLDNSCDQRQDLPSDQNTGALESSQCSPS
PVSQEDLESEISEDSDQEVDIEGDKGYFNAG
Download sequence
Identical sequences A7YWK1
ENSBTAP00000018899 ENSBTAP00000018899 NP_001098894.1.59421 NP_001098894.1.76553 XP_019808731.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]