SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019107 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019107
Domain Number 1 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 175-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 297-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019107   Gene: ENSBTAG00000014370   Transcript: ENSBTAT00000019107
Sequence length 526
Comment pep:known chromosome:UMD3.1:18:15541254:15594951:-1 gene:ENSBTAG00000014370 transcript:ENSBTAT00000019107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQLFNLSSLISLVLLVTVLVVEGIAVAQKTQDGQNIGMKHVPATQCGIWVRTSNGGHFAS
PNYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEIRDGPFGFSPLID
RYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQF
ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFV
AVYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTG
STFFCHSNMCINNSLVCNGIQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIVL
VLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEMSADLADLSEEL
DSYQKTRRSSTASRCIHDHHCGSQAPSAKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFK
KSSYTFKQAHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences F1N590
ENSBTAP00000019107 9913.ENSBTAP00000019107 ENSBTAP00000019107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]