SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019142 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019142
Domain Number 1 Region: 373-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 406-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000648
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019142   Gene: ENSBTAG00000014396   Transcript: ENSBTAT00000019142
Sequence length 470
Comment pep:known chromosome:UMD3.1:14:63951758:63957275:1 gene:ENSBTAG00000014396 transcript:ENSBTAT00000019142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EERMEMICERSKENVYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYIENRPVTPVSDTS
EEENLLPGTPDFHTTIPAFCLTPPYSPSDFEPSQVSNLMAPAPPTGHFKSLSDTAKPHIA
AVPFKEEKNPVPAPKLPKAQATSVIRHTADAQLCNHRSCPVKAASILNYQDNSFRKRTHL
NPEAARKNIPCAAVSPNRSKRERDTEADVEEKPSPAALYDFSVPSSETVICRPQPAPASP
QQKSVLVSPPAVSTAGVPPMPVICQMVPLPAHNPVVTTVVPSTPPSQPPAVCPPVVFMGT
QVPKGALMFVVPQPVVQNPKPPVVSPNGTRLSPIAPAPGFSPSSAKVTPQIDSSRIRSHI
CSHPGCGKTYFKSSHLKAHMRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFA
CPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDISLPPTPAPTQ
Download sequence
Identical sequences F6QKI1
ENSBTAP00000019142 ENSBTAP00000019142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]